Dataset for protein Bad of organism Poecilia mexicana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B3YFR1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Poecilia mexicana GN=BAD (length=166 residues).
MDAKFTISDSDSEPSEDVEERGNLQLMQVKERPLSQRHTLTLPELRSTTGRVRLNSESIASTISREEELQARGEEEVGTP
TEGFPFRGRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLDKGEMRKVSSTGSNRPIHHSRSWWSYLFSHQETEGENNHHEN
HASRTE
© 1998-2019