Dataset for protein classical BH3-containing proteins of organism Poecilia formosa

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A087X8P8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Poecilia formosa GN=BAD (length=166 residues).
MDAKFTISDSDSEPSEDVEERGNLQLMQVKERPLSQRHTLTLPELRSTTGRVRLNSESIASTISREEELQARGEEEVGTP
TEGFPFRGRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLDKGEMRKVSSTGSNRPIHHSRSWWSYLFSHQETEGENNHHEN
HASRTE
>gnl|bcl2dbpro|A0A096LRV0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Poecilia formosa GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHFPAHFELVGDFDARQ
QEEQNRMEQLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFHRGFIAGGGGAGRR
© 1998-2018