Dataset for protein Bmf of organism Poecilia formosa

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A096LRV0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Poecilia formosa GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHFPAHFELVGDFDARQ
QEEQNRMEQLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFHRGFIAGGGGAGRR
© 1998-2018