Dataset for protein Bmf of organism Periophthalmus magnuspinnatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B4B6Y3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BMF (length=120 residues).
MEDEEDDVFEPDLHCWHTTFRQIKCEDRATQTPGPALAPNKGMLPCGVAEEPRPLFYAHFELGEDQEASESLQEGEMQNG
REPLPRHPVAVRSMEACIGHKLQLIGDQFHRDHLQRVREH
© 1998-2019