Dataset for protein Bmf of organism Pelodiscus sinensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|K7FRX2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pelodiscus sinensis GN=BMF (length=193 residues).
MDPPSYLEEDYSSLDGLDDDVFHSDDFGLTGQPGEMTPTGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQT
LSPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHEPPVGFALNPHLQEEPREGHQEARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQILLFLHNLALNVEANRNHIGQR
© 1998-2018