Dataset for protein Bim of organism Pelodiscus sinensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|K7GA86_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL2L11 (length=225 residues).
MGRAGRGPGAAQSVQAPRRVPAFCPVAGGSERAAARFPAPAGADSERRGLAEELLLEPDSLLFRQSLSASYSLDAGKGDQ
MAKQPSDLNSECDGEGGQFQSIERPSQPQHLRPGAPTSIQTQYQDRSPVPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHA
SRWESPSIREDMQPEIWIAQELRRIGDEFNASYCPRRGFLDNQAINHQIVLRLLHYIIRLIWRMQ
© 1998-2018