Dataset for protein classical BH3-containing proteins of organism Paramormyrops kingsleyae

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3B3QC78_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BCL2L11 (length=190 residues).
MGQILLTIPCSVCSAEDKITRMAESRNPVAEQTPIQAGPRTAKVPGQLQATPRFSTLSASSSGYHSLDISLPNSPFMTHN
KSTQTPSPSNHLVCIYLSSVTRTLSMLPDMRPEMLVARELRRIGDKFNDIYINGVSILLCPHCPLRPTAMGQGATLTPYP
GDNKNKESPLRSRSSWLHVRMGEVEQQEIV
>gnl|bcl2dbpro|A0A3B3QX41_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BAD (length=169 residues).
MSGVTMAHMFTISGNESDTSESDTPDVTANSQLGNNLKNTKNPGEAGGRVRMRSESQVSSIRSEDLDFGEGGASEEGGGV
CPGDGTPFRGRSRSAPPALWAAQRYGRQLRRMSDEFDTLLDKGMKRVRSAGAARQMQASPSWFAFLWSHKESDAEISGSL
STADSRAAQ
>gnl|bcl2dbpro|A0A3B3RH63_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BMF (length=146 residues).
MDDDDDDVFHTDPLTYQPPFRDIKCENRGTQTPGPALVQGLNMLPCGVGQEPRRLFYGSAGLRLHFPALSVPGGHPPQEE
RQPDDRPQPSAEVRIGQKLQMIGDQFHQDQLQLYHRNQRNQQPVWWRLVMALCGLLFERRQRAEQR
© 1998-2019