Dataset for protein Bmf of organism Paramormyrops kingsleyae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B3RH63_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BMF (length=146 residues).
MDDDDDDVFHTDPLTYQPPFRDIKCENRGTQTPGPALVQGLNMLPCGVGQEPRRLFYGSAGLRLHFPALSVPGGHPPQEE
RQPDDRPQPSAEVRIGQKLQMIGDQFHQDQLQLYHRNQRNQQPVWWRLVMALCGLLFERRQRAEQR
© 1998-2019