Dataset for protein Bim of organism Paramormyrops kingsleyae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B3QC78_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BCL2L11 (length=190 residues).
MGQILLTIPCSVCSAEDKITRMAESRNPVAEQTPIQAGPRTAKVPGQLQATPRFSTLSASSSGYHSLDISLPNSPFMTHN
KSTQTPSPSNHLVCIYLSSVTRTLSMLPDMRPEMLVARELRRIGDKFNDIYINGVSILLCPHCPLRPTAMGQGATLTPYP
GDNKNKESPLRSRSSWLHVRMGEVEQQEIV
© 1998-2019