Dataset for protein Bmf of organism Papio anubis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A096NTE9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Papio anubis GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|A0A096NTE9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Papio anubis GN=BMF (length=206 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGVDPRYKNARRSVRKLKASSFLSCQPE
>gnl|bcl2dbpro|A0A096NTE9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Papio anubis GN=BMF (length=196 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGVDPRPLTWNGAVVKPC
© 1998-2018