Dataset for protein Bik of organism Papio anubis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A096NKG5_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Papio anubis GN=BIK (length=160 residues).
MSGVRPISRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLALLLLLALLLALLSGGLHLLLK
© 1998-2018