Dataset for protein Puma of organism Papio anubis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2I3N2Z9_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Papio anubis GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
© 1998-2018