Dataset for protein Bad of organism Papio anubis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A2I3MCN5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Papio anubis GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLG
RGSSAPSQ
>gnl|bcl2dbpro|A0A2I3MCN5_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Papio anubis GN=BAD (length=163 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGRAWYSPSWESEDSENPS
ARMLAEASAPMSAPATDSEAQHAENVKLKALGLWRRGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAAS
SGG
>gnl|bcl2dbpro|A0A2I3MCN5_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Papio anubis GN=BAD (length=156 residues).
MFQIPEFEPSEQEDSRSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGTSSPEERGHSDADAAKL
QLDASLPVLVGSELGQGKLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCKRGSVLPLSVGGLTQIPFRCM
>gnl|bcl2dbpro|A0A2I3MCN5_BAD-04 BCL2-associated agonist of cell death protein OS=[Eukaryota] Papio anubis GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSRSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
© 1998-2018