Dataset for protein Bik of organism Pan troglodytes

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H2QLU7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Pan troglodytes GN=BIK (length=160 residues).
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGVTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQL
SDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLALLLLLALLLPLLSGGLHLLLK
© 1998-2018