Dataset for protein Bad of organism Pan troglodytes

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2I3TBK7_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pan troglodytes GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGT
EDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLG
RGSSAPSQ
>gnl|bcl2dbpro|A0A2I3TBK7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pan troglodytes GN=BAD (length=157 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGEGTSSPEERGHSNPDAAK
LQLDASLPVLVGSELGQGKLRPLPVTFAPHPETPPVPTALGSHLEYGRKYFPQAYAKRGSVLSPLEGGLTPIPFRCV
>gnl|bcl2dbpro|A0A2I3TBK7_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pan troglodytes GN=BAD (length=163 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGRTSYSPSWESEDSENPS
AGMLAEASAGMSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAAS
SGG
© 1998-2018