Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Alignment] [Repertoires]

20 sequence(s)

>gnl|bcl2dbpro|A0A2R8Z697_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pan paniscus GN=BAD (length=163 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASHQQEQPTSSSHHGGRTSYSPSWESEDSENPS
AGMLAEASAGMSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAAS
SGG
>gnl|bcl2dbpro|A0A2R8Z697_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pan paniscus GN=BAD (length=157 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASHQQEQPTSSSHHGEGTSSPEERGHSNADAAK
LQLDASLPVLVGSELGQGKLRPLPVTFAPHPETPPVPTALGSHLEYGRKYFPQAYAKRGSVLSPLEGGLTQIPFRCV
>gnl|bcl2dbpro|A0A2R8Z697_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pan paniscus GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGT
EDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLG
RGSSAPSQ
>gnl|bcl2dbpro|A0A2R8ZXD2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Pan paniscus GN=BIK (length=160 residues).
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGVTESEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQL
SDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPRSWVSREQVLLALLLLLALLLPLLSGGLHLLLK
>gnl|bcl2dbpro|A0A2R9AKC9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pan paniscus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A2R9AKC9_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pan paniscus GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIGMQLRFTRGKKLLSSSSSSPLALPRGHEEQAQVAGSRVCYSTQEIWR
QTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW
>gnl|bcl2dbpro|A0A2R9BS98_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pan paniscus GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2R9BS98_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Pan paniscus GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
>gnl|bcl2dbpro|A0A2R9BZA9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Pan paniscus GN=BBC3 (length=101 residues).
MKFGMGSAQACPCQVPRAASVTWVPCQICETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS
GGRPLPPPDTLASAGDFLCTM
>gnl|bcl2dbpro|A0A2R9BZA9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Pan paniscus GN=BBC3 (length=131 residues).
MKFGMGSAQACPCQVPRAASVTWVPCQICGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=84 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKL
LSST
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRMPLPPD
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
LSLCFGFIFTGLDLYGHHHSQDAEQLNHKDFS
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=98 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLR
IALHREVQWPLKWLAKSS
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
© 1998-2018