Dataset for protein Puma of organism Pan paniscus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2R9BZA9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Pan paniscus GN=BBC3 (length=131 residues).
MKFGMGSAQACPCQVPRAASVTWVPCQICGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
© 1998-2018