Dataset for protein Bad of organism Pan paniscus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2R8Z697_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pan paniscus GN=BAD (length=163 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASHQQEQPTSSSHHGGRTSYSPSWESEDSENPS
AGMLAEASAGMSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAAS
SGG
>gnl|bcl2dbpro|A0A2R8Z697_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pan paniscus GN=BAD (length=157 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASHQQEQPTSSSHHGEGTSSPEERGHSNADAAK
LQLDASLPVLVGSELGQGKLRPLPVTFAPHPETPPVPTALGSHLEYGRKYFPQAYAKRGSVLSPLEGGLTQIPFRCV
>gnl|bcl2dbpro|A0A2R8Z697_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pan paniscus GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGT
EDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLG
RGSSAPSQ
© 1998-2018