Dataset for protein Unclassified of organism Ovis aries

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5P3K2_uncHRK-01 Putative Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Ovis aries (length=43 residues).
MWRRRARGGGAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
© 1998-2019