Dataset for protein classical BH3-containing proteins of organism Ovis aries

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|W5P738_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ovis aries GN=PMAIP1 (length=54 residues).
MPGRRARRSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLIAKLLRSGT
>gnl|bcl2dbpro|W5P8G9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ovis aries GN=BAD (length=179 residues).
QGPRYRAWAQSMFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVET
RSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTR
FLQSWLSRNLGRGGSAPSQ
>gnl|bcl2dbpro|W5PY58_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ovis aries GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAY
YPRRVFVRHQAIEGHPQMVLLRVLRYLVRLVWRMQ
>gnl|bcl2dbpro|W5QCU2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ovis aries GN=BIK (length=148 residues).
MYQARPLSRNLFLYTFLQNHGPGFLDDQGSGLPGVTSILEFHPISPYSDSPHYLAMQLASIADEMELRLLLPQFVEPFWM
PMYSLCFPYSHVGLRDVLRSFMVAFTNLRENRRLWSFLTLRDRVSPSLWPELALSLLVVAMLSWGCRF
>gnl|bcl2dbpro|W5QFV1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ovis aries GN=BMF (length=188 residues).
LTGEMEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNR
NRMWWQILLFLHNVALNGDENRNGAGPR
© 1998-2018