Dataset for protein Bmf of organism Ovis aries

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5QFV1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ovis aries GN=BMF (length=188 residues).
LTGEMEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNR
NRMWWQILLFLHNVALNGDENRNGAGPR
© 1998-2018