Dataset for protein Bik of organism Ovis aries

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5QCU2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ovis aries GN=BIK (length=148 residues).
MYQARPLSRNLFLYTFLQNHGPGFLDDQGSGLPGVTSILEFHPISPYSDSPHYLAMQLASIADEMELRLLLPQFVEPFWM
PMYSLCFPYSHVGLRDVLRSFMVAFTNLRENRRLWSFLTLRDRVSPSLWPELALSLLVVAMLSWGCRF
© 1998-2018