Dataset for protein Bad of organism Ovis aries

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5P8G9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ovis aries GN=BAD (length=179 residues).
QGPRYRAWAQSMFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVET
RSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTR
FLQSWLSRNLGRGGSAPSQ
© 1998-2018