Dataset for protein classical BH3-containing proteins of organism Otolemur garnettii

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|H0WVR2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Otolemur garnettii GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSSDRGLGPSPSGDQPLGPGKNRCTTPSLLGDASHLQGQPASNTHHGAGPGAVETRSRHSSYPAG
TEEDEGIEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFKKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNVG
RGGSAPCQ
>gnl|bcl2dbpro|H0WYH6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Otolemur garnettii GN=BMF (length=182 residues).
MEPSQCVEELEDDVFQPEDGELGTGNVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGV
MLPCGVTEEPQRLFYGNVGYRLPLPASFPAGLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQ
VLFFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|H0XAE7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Otolemur garnettii GN=BIK (length=147 residues).
MSAGRPVSMDHFMETFPFEQLLEPLTMEVLGMTEPNPMECLEDSDQVALRLACIGDEMDLHLRSPRLAQLSRMTMHSLGL
SYNQTDGQGVLRSVISGFTNLRENIAGFWRSLSRGPWVCPAPAWEQVLLLLLLLVLLLAGGLHLLLK
>gnl|bcl2dbpro|H0XQ00_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Otolemur garnettii GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTATLGGPRWPGG
PRSRPRGPRLDGPQPSLLPAEQHLESPVPSTPGALAGGPTQAAPEVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|H0XW23_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Otolemur garnettii GN=BCL2L11 (length=200 residues).
MAKQPSDVGSECDREGGQLQPAERPPQLRPGAPTSLHTEPQGNPEGNPEVEGDRCPQGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADLRPEMWIAQELRRIGDE
FNAYYPTRVFLHNYQAAEDHPQMVILRLLRYIVRLVWRLH
>gnl|bcl2dbpro|H0Y001_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Otolemur garnettii GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALTTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2018