Dataset for protein Bmf of organism Otolemur garnettii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H0WYH6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Otolemur garnettii GN=BMF (length=182 residues).
MEPSQCVEELEDDVFQPEDGELGTGNVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGV
MLPCGVTEEPQRLFYGNVGYRLPLPASFPAGLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQ
VLFFLHNLALNGEENRNGAGPR
© 1998-2018