Dataset for protein Bik of organism Otolemur garnettii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H0XAE7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Otolemur garnettii GN=BIK (length=147 residues).
MSAGRPVSMDHFMETFPFEQLLEPLTMEVLGMTEPNPMECLEDSDQVALRLACIGDEMDLHLRSPRLAQLSRMTMHSLGL
SYNQTDGQGVLRSVISGFTNLRENIAGFWRSLSRGPWVCPAPAWEQVLLLLLLLVLLLAGGLHLLLK
© 1998-2018