Dataset for protein Puma of organism Otolemur garnettii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H0XQ00_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Otolemur garnettii GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTATLGGPRWPGG
PRSRPRGPRLDGPQPSLLPAEQHLESPVPSTPGALAGGPTQAAPEVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
© 1998-2018