Dataset for protein Bad of organism Otolemur garnettii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H0WVR2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Otolemur garnettii GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSSDRGLGPSPSGDQPLGPGKNRCTTPSLLGDASHLQGQPASNTHHGAGPGAVETRSRHSSYPAG
TEEDEGIEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFKKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNVG
RGGSAPCQ
© 1998-2018