Dataset for protein classical BH3-containing proteins of organism Oryzias melastigma

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B3BQF7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oryzias melastigma GN=BAD (length=169 residues).
MAAKFSISDNDSESSEEVEGGRLDLAASGGEGGGGGGGHLHDRHALTLPELRLTSNGRTRLNSESTVSTYSRDEDLPRED
EAGTPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSAGATKQMHHSTSWWNYLFSHPEAEGEY
SHHESHRTE
>gnl|bcl2dbpro|A0A3B3CGR9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias melastigma GN=BMF (length=163 residues).
MDDEEDDVFEPDPNNWRTAVRKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEARR
HDREAERGGMERLPRQQPAARSTEACIAQKLQLIGDQFHRERLQLYHQNQRNQGPLWWRLTTALVSLLLDRGFIAGGGGA
GQR
© 1998-2019