Dataset for protein Bad of organism Oryzias melastigma

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B3BQF7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oryzias melastigma GN=BAD (length=169 residues).
MAAKFSISDNDSESSEEVEGGRLDLAASGGEGGGGGGGHLHDRHALTLPELRLTSNGRTRLNSESTVSTYSRDEDLPRED
EAGTPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSAGATKQMHHSTSWWNYLFSHPEAEGEY
SHHESHRTE
© 1998-2019