Dataset for protein classical BH3-containing proteins of organism Oryzias latipes

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A3B3HDU2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oryzias latipes GN=BAD (length=164 residues).
MAAKFTISDDSESSEEVEGGKLDLGAAAGGEGEHLHDRHSLTLPELRLTSNGRTRLNSESTASTYSRDEDLAREDEAGTP
TDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSTGAAKQMLHSTSWWNYLFSHPEAEGEYSHHES
HRTE
>gnl|bcl2dbpro|A0A3B3I0V9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3I0V9_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=169 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQRQSVVSD
>gnl|bcl2dbpro|A0A3B3I0V9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3I0V9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9JM16_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9JM16_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9JM16_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
© 1998-2019