Dataset for protein Bmf of organism Oryzias latipes

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A3B3I0V9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3I0V9_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=169 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQRQSVVSD
>gnl|bcl2dbpro|A0A3B3I0V9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3I0V9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9JM16_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9JM16_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9JM16_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
© 1998-2019