Dataset for protein Hrk of organism Oryctolagus cuniculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1T7W1_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Oryctolagus cuniculus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSAAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2018