Dataset for protein Bmf of organism Oryctolagus cuniculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1SR62_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryctolagus cuniculus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPQSLLSADPFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPANFALGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHLQQHQQNRNRVW
WQILLFLHNLALNGDENRDGAGPR
© 1998-2018