Dataset for protein Bik of organism Oryctolagus cuniculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1TZR9_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Oryctolagus cuniculus GN=BIK (length=152 residues).
MSEVRPGSRDLFQEALLDEQVPEPLLTAEVPGLTRPVEEGDLDLMECLEGSNQVALRLAYIGDEMDLHVRGLHTGPAAGV
AMHSLAFTYSQTGFTGVLGSVGLHLASLVELWSPWGRGAAAPAAVRPLPGQGWPPSWRVVLLGAGSWGLRMP
© 1998-2018