Dataset for protein Bad of organism Oryctolagus cuniculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1SS60_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oryctolagus cuniculus GN=BAD (length=114 residues).
PRPKPLSAGAGAMETRSRHSSYPADADDSEGAEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSVKKGLPRPKS
AGTAMQMRESSSWTRVIQSWWDRNLGKGGSAPSQ
© 1998-2018