Dataset for protein classical BH3-containing proteins of organism Ornithorhynchus anatinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7FTC8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2L11 (length=144 residues).
MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQDRSPPPVSCDKSTQTPSPHCQAFNHYLSAMASIRQP
QSVPEDMRPEIWIAQELRRIGDEFNASYCPRRGLLDNNNPAGNNHQMGFVHLLRYIIRRVWRLQ
© 1998-2018