Dataset for protein classical BH3-containing proteins of organism Oreochromis niloticus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|I3K2D6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oreochromis niloticus GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRARR
QEIAEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAALLSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|I3K7B6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oreochromis niloticus GN=BAD (length=145 residues).
MAANFTISDSESETSEEVGEEENQQPAGQDQESKPQTLALPVIKTTVQPNQWNALGMRDEDLMARGEDEVCTPTEGDPFR
RRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMKLKKLHHSKTWWSYLFSHQETEGENNHLE
© 1998-2018