Dataset for protein Bmf of organism Oreochromis niloticus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|I3K2D6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oreochromis niloticus GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRARR
QEIAEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAALLSLLFDRGFIAGGGGG
GRR
© 1998-2018