Dataset for protein Bad of organism Oreochromis niloticus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|I3K7B6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oreochromis niloticus GN=BAD (length=145 residues).
MAANFTISDSESETSEEVGEEENQQPAGQDQESKPQTLALPVIKTTVQPNQWNALGMRDEDLMARGEDEVCTPTEGDPFR
RRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMKLKKLHHSKTWWSYLFSHQETEGENNHLE
© 1998-2018