Dataset for protein Hrk of organism Nomascus leucogenys

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1QHD8_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Nomascus leucogenys GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2018