Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Alignment] [Repertoires]

14 sequence(s)

>gnl|bcl2dbpro|A0A2I3H4B2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Nomascus leucogenys GN=BAD (length=82 residues).
MGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAP
SQ
>gnl|bcl2dbpro|A0A2I3HD83_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Nomascus leucogenys GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQEWGRP
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDVGD
ISLWFGFIFTGLDLYGHHHSQDTEQFNHKDFS
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=92 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEAAGSSLE
VQWPFEWLAKSS
>gnl|bcl2dbpro|A0A2I3HWI8_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Nomascus leucogenys GN=BBC3 (length=107 residues).
MKFGMGSARACPCQVPRASSVTWVPCQICAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPS
PWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2I3HX97_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Nomascus leucogenys GN=PMAIP1 (length=53 residues).
KPGRARRNAQPSPAPAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|G1QHD8_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Nomascus leucogenys GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|G1S1X2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Nomascus leucogenys GN=BIK (length=159 residues).
MSEVRPISRDILMESLLYEQLLEPPTMEVLGVTDPEEDLDPMEDFDPLQCMEGSDALAPRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTFKENIIRLWRSPNPGSRVSREQMLLVLLVLLLLLLPLLSGGLYLLN
© 1998-2018