Dataset for protein Bmf of organism Nomascus leucogenys

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2I3HD83_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Nomascus leucogenys GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQEWGRP
© 1998-2018