Dataset for protein Bik of organism Nomascus leucogenys

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1S1X2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Nomascus leucogenys GN=BIK (length=159 residues).
MSEVRPISRDILMESLLYEQLLEPPTMEVLGVTDPEEDLDPMEDFDPLQCMEGSDALAPRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTFKENIIRLWRSPNPGSRVSREQMLLVLLVLLLLLLPLLSGGLYLLN
© 1998-2018