Dataset for protein Bad of organism Nomascus leucogenys

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2I3H4B2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Nomascus leucogenys GN=BAD (length=82 residues).
MGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAP
SQ
© 1998-2018