Dataset for protein Bmf of organism Neovison vison

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|U6CSY8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Neovison vison GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGDQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADGNRNGAGPR
© 1998-2019