Dataset for protein classical BH3-containing proteins of organism Neolamprologus brichardi

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q4G1I4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Neolamprologus brichardi GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYQRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|A0A3Q4GGN3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Neolamprologus brichardi GN=BAD (length=158 residues).
MAANFKISDSDSETSEEVGEGENQQSARQVQESKPQTLSLPVIKTTAAGRLRVNSESHTSSIARDEELMARGEDEVCTPT
EGDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMKLKKLHHSKTWWSYLFSHQETEGENNHLENHNQRTE
© 1998-2019