Dataset for protein Unclassified of organism Myotis lucifugus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1PFC4_uncBIK-01 Putative BCL2-interacting killer protein OS=[Eukaryota] Myotis lucifugus (length=80 residues).
MSQAGHLSRSLILCTFLQEHGLQAVEDPGVTSLLQYSPEPLGPRRALPHEVAMRLAFIGDELEVRWTLPRFAHVPWMAMY
© 1998-2018