Dataset for protein Noxa of organism Myotis lucifugus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1P8F9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Myotis lucifugus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAPAEAEIECALQLRRIGDKLSFLQKLLNLMYKLFGSGT
© 1998-2018