Dataset for protein classical BH3-containing proteins of organism Myotis lucifugus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|G1P8C5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Myotis lucifugus GN=BAD (length=174 residues).
PTAQSMFQIPEFEHSEQEDSSPADRGLGPCPTGDQPPGLNKHWSTVPGLLGEAGHQQGQPASSSHHDGAGSVEPRSRHSS
YPTGTEEDDDTEEGEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFQGSFKKGLPRPKSAGTATQMWQKSSWTRFFQSW
WDRNSGRGGSAPSQ
>gnl|bcl2dbpro|G1P8F9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Myotis lucifugus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAPAEAEIECALQLRRIGDKLSFLQKLLNLMYKLFGSGT
>gnl|bcl2dbpro|G1PAU1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Myotis lucifugus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDELGTQPGSLPSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQWQHHRAEIQIARKLQSIADQFHRLQMQQHQQNRNRMW
WQFLLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|G1PDJ5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Myotis lucifugus GN=BCL2L11 (length=70 residues).
SMQQSQALPVDMRPEMWIAQELRRIGDEFNNSYRNPRRDFLNVYREAEGHPQMVVLRLLRYILRLVWRRM
© 1998-2018